SCOPe 2.07: Domain d4wbnd2: 4wbn D:246-441

Lineage for d4wbnd2 (4wbn D:246-441)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

8. Domain d4wbnd2: 4wbn D:246-441 [261730]
   Other proteins in same PDB: d4wbna1, d4wbnb1, d4wbnc1, d4wbnd1, d4wbne_, d4wbnf1, d4wbnf2, d4wbnf3
   automated match to d3rycd2
   complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d4wbnd2

PDB Entry: 4wbn, 2.3 Å

PDB Description: crystal structure of tubulin-stathmin-ttl complex solved by native-sad phasing

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4wbnd2:

Sequence, based on SEQRES records:

>d4wbnd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records):

>d4wbnd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltltvpeltqqmfdsknmmaacdprhgrylt
vaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignst
aiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

Timeline for d4wbnd2:

• d4wbnd2 first appeared in SCOPe 2.04
  
• d4wbnd2 appears in SCOPe 2.06
  
• d4wbnd2 does not appear in SCOPe 2.08