SCOPe 2.07: Domain d4v2gb1: 4v2g B:3-67

Lineage for d4v2gb1 (4v2g B:3-67)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)

8. Domain d4v2gb1: 4v2g B:3-67 [261724]
   Other proteins in same PDB: d4v2ga2, d4v2ga3, d4v2gb2, d4v2gb3
   automated match to d1bjza1
   complexed with ctc, itc, mg

Details for d4v2gb1

PDB Entry: 4v2g, 2.71 Å

PDB Description: Tetracycline repressor TetR(D) bound to chlortetracycline and iso- chlortetracycline

PDB Compounds: (B:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4v2gb1:

Sequence; same for both SEQRES and ATOM records:

>d4v2gb1 a.4.1.9 (B:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

Timeline for d4v2gb1:

• d4v2gb1 first appeared in SCOPe 2.04
  
• d4v2gb1 appears in SCOPe 2.06
  
• d4v2gb1 appears in the current release, SCOPe 2.08