Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (21 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [197235] (2 PDB entries) |
Domain d4cvyc_: 4cvy C: [261654] automated match to d3swtb_ complexed with fe, no3 |
PDB Entry: 4cvy (more details), 2 Å
SCOPe Domain Sequences for d4cvyc_:
Sequence, based on SEQRES records: (download)
>d4cvyc_ b.82.2.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} litvkklgsrigaqidgvrlggdldpaavneiraallahkvvffrgqhqlddaeqlafag llgtpighpaaialaddapiitpinsefgkanrwhtdvtfaanypaasvlravslpsygg stlwantaaayaelpeplkcltenlwalhtnrydyvttkpltaaqrafrqvfekpdfrte hpvvrvhpetgertllagdfvrsfvgldshesrvlfevlqrritmpentirwnwapgdva iwdnratqhraiddyddqhrlmhrvtlmgdvpvdvygqasrvi
>d4cvyc_ b.82.2.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} litvkklgsrigaqidgvrlggdldpaavneiraallahkvvffrgqhqlddaeqlafag llgtpianrwhtdvtfaanypaasvlravslpsyggstlwantaaayaelpeplkclten lwalhtnpdfrtehpvvrvhpetgertllagdfvrsfvgldshesrvlfevlqrritmpe ntirwnwapgdvaiwdnratqhraiddyddqhrlmhrvtlmgdvpvdvygqasrvi
Timeline for d4cvyc_: