SCOPe 2.04: Domain d3zopc_: 3zop C:

Lineage for d3zopc_ (3zop C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)
   automatically mapped to Pfam PF07736

6. Protein Chorismate mutase [55305] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [55306] (10 PDB entries)

8. Domain d3zopc_: 3zop C: [261644]
   automated match to d1dbfa_

Details for d3zopc_

PDB Entry: 3zop, 1.61 Å

PDB Description: Arg90Cit chorismate mutase of Bacillus subtilis at 1.6 A resolution

PDB Compounds: (C:) chorismate mutase aroh

SCOPe Domain Sequences for d3zopc_:

Sequence; same for both SEQRES and ATOM records:

>d3zopc_ d.79.1.2 (C:) Chorismate mutase {Bacillus subtilis [TaxId: 1423]}
mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak
avrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqeqirhvylekavvlrp

Timeline for d3zopc_:

• d3zopc_ is new in SCOPe 2.04-stable
  
• d3zopc_ appears in SCOPe 2.05
  
• d3zopc_ appears in the current release, SCOPe 2.08