Lineage for d4wkea_ (4wke A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918487Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1918488Protein automated matches [190805] (14 species)
    not a true protein
  7. 1918507Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries)
  8. 1918522Domain d4wkea_: 4wke A: [261634]
    automated match to d3ljta_
    complexed with 3pu, ca, edo, zn

Details for d4wkea_

PDB Entry: 4wke (more details), 1.62 Å

PDB Description: Crystal structure of human ADAMTS-4 in complex with inhibitor 5-chloro-N-{[(4R)-2,5-dioxo-4-(1,3-thiazol-2-yl)imidazolidin-4-yl]methyl}-1-benzofuran-2-carboxamide (compound 10)
PDB Compounds: (A:) A disintegrin and metalloproteinase with thrombospondin motifs 4

SCOPe Domain Sequences for d4wkea_:

Sequence, based on SEQRES records: (download)

>d4wkea_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsrfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgsg
eegpqvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadv
gtvcdparscaiveddglqsaftaahelghvfnmlhdnskpcislngplstsrhvmapvm
ahvdpeepwspcsarfitdfldngyghclldkpeaplhlp

Sequence, based on observed residues (ATOM records): (download)

>d4wkea_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsrfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilegp
qvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvgtvc
dparscaiveddglqsaftaahelghvfnmlhdnskpcislngplsrhvmapvmahvdpe
epwspcsarfitdfldngyghclldkpeaplhlp

SCOPe Domain Coordinates for d4wkea_:

Click to download the PDB-style file with coordinates for d4wkea_.
(The format of our PDB-style files is described here.)

Timeline for d4wkea_: