SCOPe 2.05: Domain d4wk7a_: 4wk7 A:

Lineage for d4wk7a_ (4wk7 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries)

8. Domain d4wk7a_: 4wk7 A: [261633]
   automated match to d3ljta_
   complexed with 3pq, ca, zn

Details for d4wk7a_

PDB Entry: 4wk7, 1.24 Å

PDB Description: crystal structure of human adamts-4 in complex with inhibitor (compound 1, 2-(4-chlorophenoxy)-n-{[(4r)-4-methyl-2,5- dioxoimidazolidin-4-yl]methyl} acetamide)

PDB Compounds: (A:) A disintegrin and metalloproteinase with thrombospondin motifs 4

SCOPe Domain Sequences for d4wk7a_:

Sequence, based on SEQRES records:

>d4wk7a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgsge
egpqvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvg
tvcdparscaiveddglqsaftaahelghvfnmlhdnskpcislngplstsrhvmapvma
hvdpeepwspcsarfitdfldngyghclldkpeapl

Sequence, based on observed residues (ATOM records):

>d4wk7a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgpqv
gpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqdlcgvstcdtlgmadvgtvcdp
arscaiveddglqsaftaahelghvfnmlhdnskpcislngplsrhvmapvmahvdpeep
wspcsarfitdfldngyghclldkpeapl

Timeline for d4wk7a_:

• d4wk7a_ first appeared in SCOPe 2.04
  
• d4wk7a_ appears in SCOPe 2.06
  
• d4wk7a_ appears in the current release, SCOPe 2.08