Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins) |
Protein CDC25b [52825] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52826] (13 PDB entries) |
Domain d4wh7a_: 4wh7 A: [261630] automated match to d1cwsa_ complexed with 8h8, gol, so4 |
PDB Entry: 4wh7 (more details), 1.62 Å
SCOPe Domain Sequences for d4wh7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wh7a_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens) [TaxId: 9606]} dhreligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeye gghiktavnlplerdaesfllkspiapcsldkrvilifhsefssergprmcrfirerdra vndypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrswa
Timeline for d4wh7a_: