SCOPe 2.04: Domain d4wh7a_: 4wh7 A:

Lineage for d4wh7a_ (4wh7 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)

6. Protein CDC25b [52825] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52826] (13 PDB entries)

8. Domain d4wh7a_: 4wh7 A: [261630]
   automated match to d1cwsa_
   complexed with 8h8, gol, so4

Details for d4wh7a_

PDB Entry: 4wh7, 1.62 Å

PDB Description: structure of the cdc25b phosphatase catalytic domain with bound ligand

PDB Compounds: (A:) M-phase inducer phosphatase 2

SCOPe Domain Sequences for d4wh7a_:

Sequence; same for both SEQRES and ATOM records:

>d4wh7a_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
dhreligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeye
gghiktavnlplerdaesfllkspiapcsldkrvilifhsefssergprmcrfirerdra
vndypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrswa

Timeline for d4wh7a_:

• d4wh7a_ is new in SCOPe 2.04-stable
  
• d4wh7a_ appears in SCOPe 2.05
  
• d4wh7a_ appears in the current release, SCOPe 2.08