SCOPe 2.04: Domain d4wbnc2: 4wbn C:246-440

Lineage for d4wbnc2 (4wbn C:246-440)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries)

8. Domain d4wbnc2: 4wbn C:246-440 [261627]
   Other proteins in same PDB: d4wbna1, d4wbnb1, d4wbnc1, d4wbnd1, d4wbne_
   automated match to d4i50a2
   complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d4wbnc2

PDB Entry: 4wbn, 2.3 Å

PDB Description: crystal structure of tubulin-stathmin-ttl complex solved by native-sad phasing

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4wbnc2:

Sequence; same for both SEQRES and ATOM records:

>d4wbnc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d4wbnc2:

• d4wbnc2 is new in SCOPe 2.04-stable
  
• d4wbnc2 appears in SCOPe 2.05
  
• d4wbnc2 last appears in SCOPe 2.07