Lineage for d4u2md1 (4u2m D:1-109)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647424Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1647425Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 1647426Species Human (Homo sapiens) [TaxId:9606] [102923] (7 PDB entries)
  8. 1647446Domain d4u2md1: 4u2m D:1-109 [261611]
    automated match to d1r2ba_

Details for d4u2md1

PDB Entry: 4u2m (more details), 2.23 Å

PDB Description: Crystal structure of a complex of the Miz1- and BCL6 POZ domains.
PDB Compounds: (D:) Zinc finger and BTB domain-containing protein 17,B-cell lymphoma 6 protein

SCOPe Domain Sequences for d4u2md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u2md1 d.42.1.1 (D:1-109) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvv
hldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitach

SCOPe Domain Coordinates for d4u2md1:

Click to download the PDB-style file with coordinates for d4u2md1.
(The format of our PDB-style files is described here.)

Timeline for d4u2md1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u2md2