SCOPe 2.08: Domain d4rurc1: 4rur C:1-234

Lineage for d4rurc1 (4rur C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d4rurc1: 4rur C:1-234 [261587]
   Other proteins in same PDB: d4rura_, d4rurc2, d4rure_, d4rurg_, d4ruri_, d4rurj_, d4rurk_, d4rurl_, d4rurn_, d4ruro_, d4rurq2, d4rurs_, d4ruru_, d4rurw_, d4rurx_, d4rury_, d4rurz_
   automated match to d1rypd_
   complexed with 3we, mg

Details for d4rurc1

PDB Entry: 4rur, 2.5 Å

PDB Description: yeast 20s proteasome in complex with the alkaloid indolo-phakellin (4)

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4rurc1:

Sequence; same for both SEQRES and ATOM records:

>d4rurc1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4rurc1:

• d4rurc1 first appeared in SCOPe 2.04, called d4rurc_
  
• d4rurc1 was called d4rurc_ in SCOPe 2.07