SCOPe 2.04: Domain d4qgea_: 4qge A:

Lineage for d4qgea_ (4qge A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Pan troglodytes [TaxId:9598] [261550] (1 PDB entry)

8. Domain d4qgea_: 4qge A: [261553]
   automated match to d2hd1a_
   complexed with 35o, mg, zn

Details for d4qgea_

PDB Entry: 4qge, 2 Å

PDB Description: phosphodiesterase-9A in complex with inhibitor WYQ-C36D

PDB Compounds: (A:) Phosphodiesterase 9A

SCOPe Domain Sequences for d4qgea_:

Sequence; same for both SEQRES and ATOM records:

>d4qgea_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Pan troglodytes [TaxId: 9598]}
kyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhd
nyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyq
inartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatd
marhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleey
fmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplw
esrdryeelkriddamkelqkk

Timeline for d4qgea_:

• d4qgea_ is new in SCOPe 2.04-stable
  
• d4qgea_ appears in SCOPe 2.05
  
• d4qgea_ appears in the current release, SCOPe 2.08