SCOPe 2.04: Domain d4piia_: 4pii A:

Lineage for d4piia_ (4pii A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.6: AgoG-like [116976] (2 proteins)
   automatically mapped to Pfam PF09171

6. Protein Hypothetical protein PF0904 [116979] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [116980] (2 PDB entries)
   Uniprot Q8U2D5

8. Domain d4piia_: 4pii A: [261549]
   automated match to d1xg7a_
   complexed with cl, imd

Details for d4piia_

PDB Entry: 4pii, 2.17 Å

PDB Description: crystal structure of hypothetical protein pf0907 from pyrococcus furiosus solved by sulfur sad using swiss light source data

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d4piia_:

Sequence; same for both SEQRES and ATOM records:

>d4piia_ a.96.1.6 (A:) Hypothetical protein PF0904 {Pyrococcus furiosus [TaxId: 2261]}
elveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrged
wwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdlegy
yknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedlriksv
tskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmkltellg

Timeline for d4piia_:

• d4piia_ is new in SCOPe 2.04-stable
  
• d4piia_ appears in SCOPe 2.05
  
• d4piia_ appears in the current release, SCOPe 2.08