Lineage for d4pgoa_ (4pgo A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1544165Protein Hypothetical protein PF0907 [110227] (1 species)
    stand-alone protein related to this domain
  7. 1544166Species Pyrococcus furiosus [TaxId:2261] [110228] (2 PDB entries)
    Uniprot Q8U2D2 18-108
  8. 1544168Domain d4pgoa_: 4pgo A: [261548]
    automated match to d1xe1a_
    complexed with cl

Details for d4pgoa_

PDB Entry: 4pgo (more details), 2.3 Å

PDB Description: crystal structure of hypothetical protein pf0907 from pyrococcus furiosus solved by sulfur sad using swiss light source data
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4pgoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pgoa_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]}
eilskkpagkvvveevvnimgkdviigtvesgmigvgfkvkgpsgiggivriernrekve
faiagdrigisiegkigkvkkgdvleiyqt

SCOPe Domain Coordinates for d4pgoa_:

Click to download the PDB-style file with coordinates for d4pgoa_.
(The format of our PDB-style files is described here.)

Timeline for d4pgoa_: