![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Hypothetical protein PF0907 [110227] (1 species) stand-alone protein related to this domain |
![]() | Species Pyrococcus furiosus [TaxId:2261] [110228] (2 PDB entries) Uniprot Q8U2D2 18-108 |
![]() | Domain d4pgoa_: 4pgo A: [261548] automated match to d1xe1a_ complexed with cl |
PDB Entry: 4pgo (more details), 2.3 Å
SCOPe Domain Sequences for d4pgoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pgoa_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} eilskkpagkvvveevvnimgkdviigtvesgmigvgfkvkgpsgiggivriernrekve faiagdrigisiegkigkvkkgdvleiyqt
Timeline for d4pgoa_: