Lineage for d4nyll2 (4nyl L:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752261Domain d4nyll2: 4nyl L:107-212 [261538]
    Other proteins in same PDB: d4nyla_, d4nylb1, d4nylc_, d4nyld1, d4nyle_, d4nylf1, d4nylh_, d4nyll1
    automated match to d1dn0a2

Details for d4nyll2

PDB Entry: 4nyl (more details), 2.8 Å

PDB Description: Crystal structure of adalimumab FAB fragment
PDB Compounds: (L:) Adalimumab Light Chain

SCOPe Domain Sequences for d4nyll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nyll2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4nyll2:

Click to download the PDB-style file with coordinates for d4nyll2.
(The format of our PDB-style files is described here.)

Timeline for d4nyll2: