Lineage for d4nnpl2 (4nnp L:109-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763511Domain d4nnpl2: 4nnp L:109-213 [261528]
    Other proteins in same PDB: d4nnpa_, d4nnpb_, d4nnpl1, d4nnpy1
    automated match to d4jg1l2

Details for d4nnpl2

PDB Entry: 4nnp (more details), 2.69 Å

PDB Description: crystal structure of apo manganese abc transporter mntc from staphylococcus aureus bound to an antagonistic fab fragment
PDB Compounds: (L:) Light chain of antagonistic fab fragment

SCOPe Domain Sequences for d4nnpl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnpl2 b.1.1.2 (L:109-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4nnpl2:

Click to download the PDB-style file with coordinates for d4nnpl2.
(The format of our PDB-style files is described here.)

Timeline for d4nnpl2: