SCOPe 2.04: Domain d4nnpl1: 4nnp L:1-108

Lineage for d4nnpl1 (4nnp L:1-108)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4nnpl1: 4nnp L:1-108 [261524]
   Other proteins in same PDB: d4nnpa_, d4nnpb_, d4nnpl2, d4nnpy2
   automated match to d3pgfl1

Details for d4nnpl1

PDB Entry: 4nnp, 2.69 Å

PDB Description: crystal structure of apo manganese abc transporter mntc from staphylococcus aureus bound to an antagonistic fab fragment

PDB Compounds: (L:) Light chain of antagonistic fab fragment

SCOPe Domain Sequences for d4nnpl1:

Sequence; same for both SEQRES and ATOM records:

>d4nnpl1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
rfsgsrsgtdftltisslqpedfatyycqqsyysspftfgqgtkveik

Timeline for d4nnpl1:

• d4nnpl1 is new in SCOPe 2.04-stable
  
• d4nnpl1 appears in SCOPe 2.05
  
• d4nnpl1 appears in the current release, SCOPe 2.08