SCOPe 2.06: Domain d4nr3b_: 4nr3 B:

Lineage for d4nr3b_ (4nr3 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)

8. Domain d4nr3b_: 4nr3 B: [261521]
   Other proteins in same PDB: d4nr3a_
   automated match to d1x23d_
   mutant

Details for d4nr3b_

PDB Entry: 4nr3, 1.8 Å

PDB Description: crystal structure of a human mms2/ubc13 l121g mutant

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4nr3b_:

Sequence; same for both SEQRES and ATOM records:

>d4nr3b_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpg
andvaeqwktneaqaietarawtrlyamn

Timeline for d4nr3b_:

• d4nr3b_ first appeared in SCOPe 2.04
  
• d4nr3b_ appears in SCOPe 2.05
  
• d4nr3b_ appears in SCOPe 2.07
  
• d4nr3b_ appears in the current release, SCOPe 2.08