Lineage for d4nbta_ (4nbt A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830526Species Acholeplasma laidlawii [TaxId:441768] [261512] (1 PDB entry)
  8. 1830527Domain d4nbta_: 4nbt A: [261516]
    automated match to d4nbub_
    complexed with nad

Details for d4nbta_

PDB Entry: 4nbt (more details), 1.48 Å

PDB Description: Crystal structure of FabG from Acholeplasma laidlawii
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d4nbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbta_ c.2.1.0 (A:) automated matches {Acholeplasma laidlawii [TaxId: 441768]}
kklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtgv
ekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqmq
tngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgyi
mtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl

SCOPe Domain Coordinates for d4nbta_:

Click to download the PDB-style file with coordinates for d4nbta_.
(The format of our PDB-style files is described here.)

Timeline for d4nbta_: