Lineage for d4nria_ (4nri A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2183831Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2183905Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries)
  8. 2183909Domain d4nria_: 4nri A: [261509]
    Other proteins in same PDB: d4nrib_
    automated match to d1j7da_
    complexed with gol; mutant

Details for d4nria_

PDB Entry: 4nri (more details), 2.3 Å

PDB Description: Crystal Structure of a human Mms2/Ubc13 A122G mutant
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d4nria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nria_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn

SCOPe Domain Coordinates for d4nria_:

Click to download the PDB-style file with coordinates for d4nria_.
(The format of our PDB-style files is described here.)

Timeline for d4nria_: