Lineage for d4czna1 (4czn A:2-364)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. Protein automated matches [190089] (9 species)
    not a true protein
  7. Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)
  8. Domain d4czna1: 4czn A:2-364 [261493]
    Other proteins in same PDB: d4czna2
    automated match to d1mnpa_
    complexed with ca, hem, na

Details for d4czna1

PDB Entry: 4czn (more details), 1.2 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from Ceriporiopsis subvermispora
PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czna1 a.93.1.1 (A:2-364) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
vcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgpsagg
gadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncpgap
rvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiaradkv
dptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdtglm
rlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvpvpk
pavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfsgpa
tds

SCOPe Domain Coordinates for d4czna1 are not available.

Timeline for d4czna1:

Domains from same chain:
(mouse over for more information)
d4czna2