Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (28 species) not a true protein |
Species Aspergillus fumigatus [TaxId:746128] [259642] (5 PDB entries) |
Domain d4uwia2: 4uwi A:263-492 [261454] automated match to d1iica2 complexed with mya, xmq |
PDB Entry: 4uwi (more details), 1.8 Å
SCOPe Domain Sequences for d4uwia2:
Sequence, based on SEQRES records: (download)
>d4uwia2 d.108.1.0 (A:263-492) automated matches {Aspergillus fumigatus [TaxId: 746128]} yyhrpldwlklyevgfsplpagstkarqitknhlpsttstpglrpmepkdidtvhdllqr ylsrfalnqaftreevdhwlvhkpetvkeqvvwayvvedpethkitdffsfynlestviq npkhdnvraaylyyyatetaftnnmkalkerllmlmndalilakkahfdvfnaltlhdnp lfleqlkfgagdgqlhfylynyrtapvpggvneknlpdekrmggvgivml
>d4uwia2 d.108.1.0 (A:263-492) automated matches {Aspergillus fumigatus [TaxId: 746128]} yyhrpldwlklyevgfsplpagstkarqitknhlpsttstpglrpmepkdidtvhdllqr ylsrfalnqaftreevdhwlvhkpevkeqvvwayvvedpethkitdffsfynlestviqn pkhdnvraaylyyyatetaftnnmkalkerllmlmndalilakkahfdvfnaltlhdnpl fleqlkfgagdgqlhfylynyrtapvpggvneknlpdekrmggvgivml
Timeline for d4uwia2: