Lineage for d4ub8u_ (4ub8 U:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738664Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 1738665Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 1738668Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (5 PDB entries)
  8. 1738671Domain d4ub8u_: 4ub8 U: [261441]
    Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8v_, d4ub8x_, d4ub8z_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8u_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d4ub8u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8u_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d4ub8u_:

Click to download the PDB-style file with coordinates for d4ub8u_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8u_: