Lineage for d4ub8m_ (4ub8 M:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (4 PDB entries)
  8. 1698711Domain d4ub8m_: 4ub8 M: [261436]
    Other proteins in same PDB: d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8h_, d4ub8i_, d4ub8k_, d4ub8l_, d4ub8u_, d4ub8v_, d4ub8z_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8m_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d4ub8m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8m_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d4ub8m_:

Click to download the PDB-style file with coordinates for d4ub8m_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8m_: