Lineage for d4ub8i_ (4ub8 I:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958533Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 1958534Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 1958535Protein Photosystem II reaction center protein I, PsbI [161043] (2 species)
  7. 1958541Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (4 PDB entries)
  8. 1958543Domain d4ub8i_: 4ub8 I: [261435]
    Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8i_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d4ub8i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d4ub8i_:

Click to download the PDB-style file with coordinates for d4ub8i_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8i_: