![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
![]() | Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
![]() | Protein automated matches [191001] (5 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (7 PDB entries) |
![]() | Domain d4ub8h_: 4ub8 H: [261434] Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_ automated match to d3bz2h_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 4ub8 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub8h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkalg
Timeline for d4ub8h_: