Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (22 PDB entries) |
Domain d4ub8e_: 4ub8 E: [261433] Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_ automated match to d2axte1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4ub8 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub8e_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]} ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi plvtdrfeakqqvetfleqlk
Timeline for d4ub8e_: