Lineage for d4ub8e_ (4ub8 E:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026746Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. 3026755Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (22 PDB entries)
  8. 3026760Domain d4ub8e_: 4ub8 E: [261433]
    Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
    automated match to d2axte1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

    has additional insertions and/or extensions that are not grouped together

Details for d4ub8e_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d4ub8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8e_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d4ub8e_:

Click to download the PDB-style file with coordinates for d4ub8e_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8e_: