SCOPe 2.06: Domain d4ub8d_: 4ub8 D:

Lineage for d4ub8d_ (4ub8 D:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (9 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (10 PDB entries)

8. Domain d4ub8d_: 4ub8 D: [261432]
   Other proteins in same PDB: d4ub8b_, d4ub8c_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
   automated match to d3arcd_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8d_

PDB Entry: 4ub8, 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser

PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d4ub8d_:

Sequence; same for both SEQRES and ATOM records:

>d4ub8d_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg
cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf
eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn
wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan
rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe
fetfytknlllnegirawmapqdqphenfvfpeevlprgnal

Timeline for d4ub8d_:

• d4ub8d_ first appeared in SCOPe 2.04
  
• d4ub8d_ appears in SCOPe 2.05
  
• d4ub8d_ appears in SCOPe 2.07
  
• d4ub8d_ appears in the current release, SCOPe 2.08