Lineage for d4ub6z_ (4ub6 Z:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697026Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (5 PDB entries)
  8. 1697224Domain d4ub6z_: 4ub6 Z: [261429]
    Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6u_, d4ub6v_
    automated match to d2axtz1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub6z_

PDB Entry: 4ub6 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d4ub6z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub6z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d4ub6z_:

Click to download the PDB-style file with coordinates for d4ub6z_.
(The format of our PDB-style files is described here.)

Timeline for d4ub6z_: