Lineage for d4ub6j_ (4ub6 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026451Protein automated matches [191002] (3 species)
    not a true protein
  7. 3026459Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)
  8. 3026463Domain d4ub6j_: 4ub6 J: [261421]
    Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6u_, d4ub6v_, d4ub6x_, d4ub6z_
    automated match to d3arcj_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub6j_

PDB Entry: 4ub6 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d4ub6j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub6j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d4ub6j_:

Click to download the PDB-style file with coordinates for d4ub6j_.
(The format of our PDB-style files is described here.)

Timeline for d4ub6j_: