Lineage for d4txoe_ (4txo E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878146Species Bradyrhizobium diazoefficiens [TaxId:224911] [260055] (2 PDB entries)
  8. 2878151Domain d4txoe_: 4txo E: [261409]
    Other proteins in same PDB: d4txob_, d4txod_, d4txof_, d4txoh_
    automated match to d1jfub_
    complexed with na, peg, scn

Details for d4txoe_

PDB Entry: 4txo (more details), 2.2 Å

PDB Description: crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)
PDB Compounds: (E:) thiol:disulfide interchange protein tlpa

SCOPe Domain Sequences for d4txoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4txoe_ c.47.1.10 (E:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]}
ptgdpacraavataqkiaplahgevaaltmasaplklpdlafedadgkpkklsdfrgktl
lvnlwatwcvpsrkempaldelqgklsgpnfevvainidtrdpekpktflkeanltrlgy
fndqkakvfqdlkaigralgmptsvlvdpqgceiatiagpaewasedalkliraatgk

SCOPe Domain Coordinates for d4txoe_:

Click to download the PDB-style file with coordinates for d4txoe_.
(The format of our PDB-style files is described here.)

Timeline for d4txoe_: