Lineage for d4p8qa2 (4p8q A:367-615)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661658Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1661659Protein automated matches [190805] (12 species)
    not a true protein
  7. 1661678Species Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries)
  8. 1661721Domain d4p8qa2: 4p8q A:367-615 [261382]
    Other proteins in same PDB: d4p8qa1, d4p8qa3, d4p8qa4
    automated match to d3se6b2
    complexed with nag, unl, zn

Details for d4p8qa2

PDB Entry: 4p8q (more details), 3.02 Å

PDB Description: Crystal Structure of Human Insulin Regulated Aminopeptidase with Alanine in Active Site
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4p8qa2:

Sequence, based on SEQRES records: (download)

>d4p8qa2 d.92.1.0 (A:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm
mktwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d4p8qa2 d.92.1.0 (A:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevnqtldvkrmm
ktwtlqkg

SCOPe Domain Coordinates for d4p8qa2:

Click to download the PDB-style file with coordinates for d4p8qa2.
(The format of our PDB-style files is described here.)

Timeline for d4p8qa2: