SCOPe 2.04: Domain d4ofta2: 4oft A:78-206

Lineage for d4ofta2 (4oft A:78-206)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (41 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224849] (4 PDB entries)

8. Domain d4ofta2: 4oft A:78-206 [261366]
   Other proteins in same PDB: d4ofta1
   automated match to d2on7a2

Details for d4ofta2

PDB Entry: 4oft, 2.6 Å

PDB Description: c- orthorombic nagst1

PDB Compounds: (A:) Glutathione S-transferase-1

SCOPe Domain Sequences for d4ofta2:

Sequence; same for both SEQRES and ATOM records:

>d4ofta2 a.45.1.0 (A:78-206) automated matches {Necator americanus [TaxId: 51031]}
agkstfdeavvdsladqysdyrveiksffytvigmregdveqlkkevllpardkffgfit
kflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypevkehmekiraipklkkw
ietrpetlf

Timeline for d4ofta2:

• d4ofta2 is new in SCOPe 2.04-stable
  
• d4ofta2 appears in SCOPe 2.05
  
• d4ofta2 appears in the current release, SCOPe 2.08