Lineage for d4nt8a_ (4nt8 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681775Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 1681776Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 1681920Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 1681921Protein automated matches [191055] (11 species)
    not a true protein
  7. 1681975Species Xanthomonas oryzae [TaxId:64187] [188927] (2 PDB entries)
  8. 1681976Domain d4nt8a_: 4nt8 A: [261360]
    automated match to d3dlda_
    complexed with act, ala, cd, fme, gol, na

Details for d4nt8a_

PDB Entry: 4nt8 (more details), 2.2 Å

PDB Description: Formyl-methionine-alanine complex structure of peptide deformylase from Xanthomoonas oryzae pv. oryzae
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d4nt8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nt8a_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvls

SCOPe Domain Coordinates for d4nt8a_:

Click to download the PDB-style file with coordinates for d4nt8a_.
(The format of our PDB-style files is described here.)

Timeline for d4nt8a_: