Lineage for d2mwba_ (2mwb A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1556382Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1556383Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1556384Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1556477Protein automated matches [192459] (3 species)
    not a true protein
  7. 1556480Species Human (Homo sapiens) [TaxId:9606] [161325] (13 PDB entries)
  8. 1556482Domain d2mwba_: 2mwb A: [261355]
    automated match to d2rm0w1
    mutant

Details for d2mwba_

PDB Entry: 2mwb (more details)

PDB Description: FBP28 WW2 mutant W457F
PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2mwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mwba_ b.72.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avsewteyktadgktyyynnrtlestfekpqelk

SCOPe Domain Coordinates for d2mwba_:

Click to download the PDB-style file with coordinates for d2mwba_.
(The format of our PDB-style files is described here.)

Timeline for d2mwba_: