Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (7 species) not a true protein |
Species Artificial gene [TaxId:32630] [193962] (5 PDB entries) |
Domain d4lnud_: 4lnu D: [261349] Other proteins in same PDB: d4lnua1, d4lnua2, d4lnub1, d4lnub2 automated match to d4duia_ complexed with gdp, gol, gtp, mes, mg, so4 |
PDB Entry: 4lnu (more details), 2.19 Å
SCOPe Domain Sequences for d4lnud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnud_ d.211.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]} dlgkklleaaragqddevrilmangadvnatdasgltplhlaatyghleivevllkhgad vnaidimgstplhlaalighleivevllkhgadvnavdtwgdtplhlaaimghleivevl lkhgadvnaqdkfgktafdisidngnedlaeilqkln
Timeline for d4lnud_:
View in 3D Domains from other chains: (mouse over for more information) d4lnua1, d4lnua2, d4lnub1, d4lnub2 |