SCOPe 2.04: Domain d4wuia_: 4wui A:

Lineage for d4wuia_ (4wui A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (24 species)
   not a true protein

7. Species Jonesia denitrificans [TaxId:471856] [261320] (1 PDB entry)

8. Domain d4wuia_: 4wui A: [261321]
   automated match to d4aaja_
   complexed with cit

Details for d4wuia_

PDB Entry: 4wui, 1.09 Å

PDB Description: crystal structure of trpf from jonesia denitrificans

PDB Compounds: (A:) n-(5'-phosphoribosyl)anthranilate isomerase

SCOPe Domain Sequences for d4wuia_:

Sequence; same for both SEQRES and ATOM records:

>d4wuia_ c.1.2.0 (A:) automated matches {Jonesia denitrificans [TaxId: 471856]}
amyikvcgltdphaidaaqaahvdaigfvhaptsprhltpphistltatvdctidtvlvv
attpiadalalaestgvsvlqlhgqysdddvayaaarfprvwratslsaspnltvgayge
elllldapqagsghtwdfaalahrrptgrwllaggltpdnvadaitttspwgvdvssgve
sapgvkdpakiaafvqaargvscpr

Timeline for d4wuia_:

• d4wuia_ is new in SCOPe 2.04-stable
  
• d4wuia_ appears in SCOPe 2.05
  
• d4wuia_ appears in the current release, SCOPe 2.08, called d4wuia1