Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (24 species) not a true protein |
Species Jonesia denitrificans [TaxId:471856] [261320] (1 PDB entry) |
Domain d4wuia_: 4wui A: [261321] automated match to d4aaja_ complexed with cit |
PDB Entry: 4wui (more details), 1.09 Å
SCOPe Domain Sequences for d4wuia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wuia_ c.1.2.0 (A:) automated matches {Jonesia denitrificans [TaxId: 471856]} amyikvcgltdphaidaaqaahvdaigfvhaptsprhltpphistltatvdctidtvlvv attpiadalalaestgvsvlqlhgqysdddvayaaarfprvwratslsaspnltvgayge elllldapqagsghtwdfaalahrrptgrwllaggltpdnvadaitttspwgvdvssgve sapgvkdpakiaafvqaargvscpr
Timeline for d4wuia_: