Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (13 PDB entries) |
Domain d4wo4a1: 4wo4 A:7-183 [261312] Other proteins in same PDB: d4wo4a2, d4wo4a3, d4wo4b_, d4wo4c1, d4wo4c2, d4wo4d1, d4wo4d2 automated match to d3hujc1 complexed with jls |
PDB Entry: 4wo4 (more details), 2.5 Å
SCOPe Domain Sequences for d4wo4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wo4a1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} lfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwetl qhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdilsf qgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d4wo4a1: