SCOPe 2.04: Domain d4tw8a1: 4tw8 A:21-140

Lineage for d4tw8a1 (4tw8 A:21-140)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FKBP52, N-terminal domains [82619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82620] (10 PDB entries)
   Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains

8. Domain d4tw8a1: 4tw8 A:21-140 [261292]
   automated match to d1q1ca1
   complexed with 37m

Details for d4tw8a1

PDB Entry: 4tw8, 3 Å

PDB Description: The Fk1-Fk2 domains of FKBP52 in complex with iFit-FL

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP4

SCOPe Domain Sequences for d4tw8a1:

Sequence; same for both SEQRES and ATOM records:

>d4tw8a1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
egvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfd
lgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge

Timeline for d4tw8a1:

• d4tw8a1 is new in SCOPe 2.04-stable
  
• d4tw8a1 appears in SCOPe 2.05
  
• d4tw8a1 appears in the current release, SCOPe 2.08