SCOPe 2.04: Domain d4rqba_: 4rqb A:

Lineage for d4rqba_ (4rqb A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (23 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:451516] [261285] (1 PDB entry)

8. Domain d4rqba_: 4rqb A: [261288]
   automated match to d3kb8b_
   complexed with cl, gol, so4, unl

Details for d4rqba_

PDB Entry: 4rqb, 2.45 Å

PDB Description: Crystal Structure of a Hypoxanthine Phosphoribosyltransferase (target ID NYSGRC-029686) from Staphylococcus aureus (tetragonal space group)

PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4rqba_:

Sequence; same for both SEQRES and ATOM records:

>d4rqba_ c.61.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 451516]}
emnsvmhndlkevllteediqnickelgaqltkdyqgkplvcvgilkgsamfmsdlikri
dthlsidfmdvssyhggtestgevqiikdlgssienkdvliiediletgttlksitellq
srkvnsleivtlldkpnrrkadieakyvgkkipdefvvgygldyrelyrnlpyigtlkpe
vysn

Timeline for d4rqba_:

• d4rqba_ is new in SCOPe 2.04-stable
  
• d4rqba_ appears in SCOPe 2.05
  
• d4rqba_ appears in the current release, SCOPe 2.08