SCOPe 2.05: Domain d4rbsa_: 4rbs A:

Lineage for d4rbsa_ (4rbs A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (15 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (29 PDB entries)

8. Domain d4rbsa_: 4rbs A: [261269]
   automated match to d4hl2a_
   complexed with 0rv, acy, gol, zn

Details for d4rbsa_

PDB Entry: 4rbs, 2.4 Å

PDB Description: Crystal Structure of New Delhi Metallo-beta-Lactamase-1 in the Complex with Hydrolyzed Meropenem

PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4rbsa_:

Sequence; same for both SEQRES and ATOM records:

>d4rbsa_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
etgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh
sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4rbsa_:

• d4rbsa_ first appeared in SCOPe 2.04
  
• d4rbsa_ appears in SCOPe 2.06
  
• d4rbsa_ appears in the current release, SCOPe 2.08