Lineage for d4pmuc_ (4pmu C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570672Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1570673Protein automated matches [190075] (60 species)
    not a true protein
  7. 1571114Species Xanthomonas axonopodis [TaxId:190486] [260217] (6 PDB entries)
  8. 1571123Domain d4pmuc_: 4pmu C: [261249]
    automated match to d4k68a_

Details for d4pmuc_

PDB Entry: 4pmu (more details), 2.86 Å

PDB Description: crystal structure of a novel reducing-end xylose-releasing exo- oligoxylanase (xyna) belonging to gh10 family (space group p1211)
PDB Compounds: (C:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d4pmuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pmuc_ c.1.8.0 (C:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat

SCOPe Domain Coordinates for d4pmuc_:

Click to download the PDB-style file with coordinates for d4pmuc_.
(The format of our PDB-style files is described here.)

Timeline for d4pmuc_: