Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) duplication: contains two structural repeats |
Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
Protein automated matches [190256] (6 species) not a true protein |
Species Pseudonocardia thermophila [TaxId:1848] [261227] (4 PDB entries) |
Domain d4ob0a_: 4ob0 A: [261232] automated match to d1ugpa_ complexed with co, pbc |
PDB Entry: 4ob0 (more details), 1.2 Å
SCOPe Domain Sequences for d4ob0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ob0a_ d.149.1.1 (A:) automated matches {Pseudonocardia thermophila [TaxId: 1848]} tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw seeelatlvtresmigvepakav
Timeline for d4ob0a_: