SCOPe 2.04: Domain d4ob0a_: 4ob0 A:

Lineage for d4ob0a_ (4ob0 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
   automatically mapped to Pfam PF02979

6. Protein automated matches [190256] (6 species)
   not a true protein

7. Species Pseudonocardia thermophila [TaxId:1848] [261227] (4 PDB entries)

8. Domain d4ob0a_: 4ob0 A: [261232]
   automated match to d1ugpa_
   complexed with co, pbc

Details for d4ob0a_

PDB Entry: 4ob0, 1.2 Å

PDB Description: crystal structure of nitrile hydratase from pseudonocardia thermophila bound to phenyl boronic acid

PDB Compounds: (A:) Cobalt-containing nitrile hydratase subunit alpha

SCOPe Domain Sequences for d4ob0a_:

Sequence; same for both SEQRES and ATOM records:

>d4ob0a_ d.149.1.1 (A:) automated matches {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

Timeline for d4ob0a_:

• d4ob0a_ is new in SCOPe 2.04-stable
  
• d4ob0a_ appears in SCOPe 2.05
  
• d4ob0a_ appears in the current release, SCOPe 2.08