Lineage for d4ih3a_ (4ih3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571126Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1571716Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1571717Protein automated matches [190150] (20 species)
    not a true protein
  7. 1571777Species Human (Homo sapiens) [TaxId:9606] [189102] (6 PDB entries)
  8. 1571793Domain d4ih3a_: 4ih3 A: [261210]
    automated match to d2wm1a_
    complexed with pdc, zn

Details for d4ih3a_

PDB Entry: 4ih3 (more details), 2.49 Å

PDB Description: 2.5 Angstroms X-ray crystal structure of of human 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid
PDB Compounds: (A:) 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4ih3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ih3a_ c.1.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkidihshilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdpevri
remdqkgvtvqalstvpvmfsywakpedtlnlcqllnndlastvvsyprrfvglgtlpmq
apelavkemercvkelgfpgvqigthvnewdlnaqelfpvyaaaerlkcslfvhpwdmqm
dgrmakywlpwlvgmpaettiaicsmimggvfekfpklkvcfahgggafpftvgrishgf
smrpdlcaqdnpmnpkkylgsfytdalvhdplslklltdvigkdkvilgtdypfplgele
pgkliesmeefdeetknklkagnalaflgler

SCOPe Domain Coordinates for d4ih3a_:

Click to download the PDB-style file with coordinates for d4ih3a_.
(The format of our PDB-style files is described here.)

Timeline for d4ih3a_: