SCOPe 2.04: Domain d3wn5f2: 3wn5 F:84-172

Lineage for d3wn5f2 (3wn5 F:84-172)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (23 PDB entries)

8. Domain d3wn5f2: 3wn5 F:84-172 [261183]
   Other proteins in same PDB: d3wn5a1, d3wn5a2, d3wn5b1, d3wn5b2, d3wn5d1, d3wn5d2, d3wn5e1, d3wn5e2
   automated match to d1fnla2
   complexed with iod, nag

Details for d3wn5f2

PDB Entry: 3wn5, 2.78 Å

PDB Description: crystal structure of asymmetrically engineered fc variant in complex with fcgriiia

PDB Compounds: (F:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d3wn5f2:

Sequence; same for both SEQRES and ATOM records:

>d3wn5f2 b.1.1.4 (F:84-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl
kdsgsyfcrglvgsknvssetvqititqg

Timeline for d3wn5f2:

• d3wn5f2 is new in SCOPe 2.04-stable
  
• d3wn5f2 appears in SCOPe 2.05
  
• d3wn5f2 appears in the current release, SCOPe 2.08