Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries) |
Domain d3wn5f1: 3wn5 F:1-83 [261182] Other proteins in same PDB: d3wn5a1, d3wn5a2, d3wn5b1, d3wn5b2, d3wn5d1, d3wn5d2, d3wn5e1, d3wn5e2 automated match to d1fnla1 complexed with iod, nag |
PDB Entry: 3wn5 (more details), 2.78 Å
SCOPe Domain Sequences for d3wn5f1:
Sequence, based on SEQRES records: (download)
>d3wn5f1 b.1.1.4 (F:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatv ddsgeyrcqtqlstlsdpvqlev
>d3wn5f1 b.1.1.4 (F:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlpkavvflepqwyrvlekdsvtlkcqgayspqstqwfhneslissqassyfidaatvdd sgeyrcqtqlstlsdpvqlev
Timeline for d3wn5f1: