SCOPe 2.05: Domain d4tn1a2: 4tn1 A:745-845

Lineage for d4tn1a2 (4tn1 A:745-845)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (19 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [260029] (2 PDB entries)

8. Domain d4tn1a2: 4tn1 A:745-845 [261155]
   Other proteins in same PDB: d4tn1a1, d4tn1b1
   automated match to d1g7sa1
   complexed with gsp, mg; mutant

Details for d4tn1a2

PDB Entry: 4tn1, 2.75 Å

PDB Description: translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas

PDB Compounds: (A:) eif5b

SCOPe Domain Sequences for d4tn1a2:

Sequence; same for both SEQRES and ATOM records:

>d4tn1a2 b.43.3.0 (A:745-845) automated matches {Chaetomium thermophilum [TaxId: 209285]}
lselqatvlevkaiegfgvtidvilsngilregdrivlcglegpiktniralltpapmre
lrikgqyihhkevkaaqgvkisapglegaiagsrllvvgpd

Timeline for d4tn1a2:

• d4tn1a2 first appeared in SCOPe 2.04
  
• d4tn1a2 appears in SCOPe 2.06
  
• d4tn1a2 appears in the current release, SCOPe 2.08