SCOPe 2.05: Domain d4rdud_: 4rdu D:

Lineage for d4rdud_ (4rdu D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (22 PDB entries)

8. Domain d4rdud_: 4rdu D: [261145]
   automated match to d1ftta_
   protein/DNA complex

Details for d4rdud_

PDB Entry: 4rdu, 1.85 Å

PDB Description: crystal structure of a distal-less homeobox protein 5 (dlx5) from homo sapiens at 1.85 a resolution

PDB Compounds: (D:) Homeobox protein DLX-5

SCOPe Domain Sequences for d4rdud_:

Sequence; same for both SEQRES and ATOM records:

>d4rdud_ a.4.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikkim
kn

Timeline for d4rdud_:

• d4rdud_ first appeared in SCOPe 2.04
  
• d4rdud_ appears in SCOPe 2.06
  
• d4rdud_ appears in the current release, SCOPe 2.08