SCOPe 2.07: Domain d4rdua_: 4rdu A:

Lineage for d4rdua_ (4rdu A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)

8. Domain d4rdua_: 4rdu A: [261144]
   automated match to d1ftta_
   protein/DNA complex

Details for d4rdua_

PDB Entry: 4rdu, 1.85 Å

PDB Description: crystal structure of a distal-less homeobox protein 5 (dlx5) from homo sapiens at 1.85 a resolution

PDB Compounds: (A:) Homeobox protein DLX-5

SCOPe Domain Sequences for d4rdua_:

Sequence; same for both SEQRES and ATOM records:

>d4rdua_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikkimk
n

Timeline for d4rdua_:

• d4rdua_ first appeared in SCOPe 2.04
  
• d4rdua_ appears in SCOPe 2.06
  
• d4rdua_ appears in the current release, SCOPe 2.08