SCOPe 2.04: Domain d4pbve2: 4pbv E:123-228

Lineage for d4pbve2 (4pbv E:123-228)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4pbve2: 4pbv E:123-228 [261121]
   automated match to d2yd3a2
   complexed with nag, so4

Details for d4pbve2

PDB Entry: 4pbv, 2.5 Å

PDB Description: crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with trkc

PDB Compounds: (E:) protein-tyrosine phosphatase crypalpha1 isoform

SCOPe Domain Sequences for d4pbve2:

Sequence; same for both SEQRES and ATOM records:

>d4pbve2 b.1.1.0 (E:123-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlredqlppgfpnidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdpstsngr
ikqlrsgglqiesseetdqgkyecvasnsagvrysspanlyvrvrr

Timeline for d4pbve2:

• d4pbve2 is new in SCOPe 2.04-stable
  
• d4pbve2 appears in SCOPe 2.05
  
• d4pbve2 appears in the current release, SCOPe 2.08