Lineage for d4oera_ (4oer A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1624950Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)
  6. 1625601Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 1625602Species Brucella suis [TaxId:29461] [259856] (1 PDB entry)
  8. 1625603Domain d4oera_: 4oer A: [261116]
    automated match to d1zlqb_
    complexed with gol, so4

Details for d4oera_

PDB Entry: 4oer (more details), 1.85 Å

PDB Description: Crystal structure of NikA from Brucella suis, unliganded form
PDB Compounds: (A:) NikA protein

SCOPe Domain Sequences for d4oera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oera_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Brucella suis [TaxId: 29461]}
dpklnfswpvnvgplnphlyspnqmfaqnmvyeplvhynadgtvgpwlaesweasqdgrs
ytfklredvkfsngevfdaaavkanidtvlqnrprhnwlelvnqmvsaevvgpykvrinl
kkpyypllqelslprpfrfiapsqfknggtadgivapigtgpwkltetklgehdvftrnd
sywgpkpayeqitvkvipdpntraiafeageidliygtegpispdtferfqkmgiyntel
sepletrvlalntnhgatkdlavrkainhavdkdtmiatvlygtqkradtlfadnvpyan
iglkpyafdpalaarlldeagwtakasgdirekdgqplaielcfigtdaisksmaeivqa
dlrkvgidvkltgeeessiyarqrdgrfdmifnqtwgapydphafvssmrvpshadyqaq
lglpdkakidaeigqvlvstdetarqalykdiltrlheeavylpltsvtamavakpevgk
itfgamsseipfekltpk

SCOPe Domain Coordinates for d4oera_:

Click to download the PDB-style file with coordinates for d4oera_.
(The format of our PDB-style files is described here.)

Timeline for d4oera_: